PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORGLA07G0166900.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 304aa    MW: 33498.9 Da    PI: 8.2716
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORGLA07G0166900.1genomeAGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA104.11.2e-32150206158
          CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                        +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+RgsgGrF
  ORGLA07G0166900.1 150 EEPIFVNAKQYHAILRRRQIRAKLEAQNKL-VKGRKPYLHESRHRHAMKRARGSGGRF 206
                        69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.5E-37148209IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.238149209IPR001289Nuclear transcription factor Y subunit A
PfamPF020451.3E-27151206IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.7E-24152174IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860154174IPR018362CCAAT-binding factor, conserved site
PRINTSPR006161.7E-24183206IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MLMLLRQMED HRAHTTPNYD FFSGDYQMKQ LGHKMYDQDS PSSDSGQSHQ EESAMNDSSP  60
NERHTSTQSD NDDGHQMPDQ DKTKSVSSLG NPGALPPKLD YSQSFACIPY TADAYYGGVL  120
TGYSSHAIVH PQQNGTANSR VPLPVEPAAE EPIFVNAKQY HAILRRRQIR AKLEAQNKLV  180
KGRKPYLHES RHRHAMKRAR GSGGRFLNTK QLEEQKQQQE EEAASGGASS GNRTCLQNGT  240
GSAPSASSPS EIASVSTSRE FLGNHEQSHF PSAGFLPTMS FRAQNGGDGK LVANAIHQRV  300
SMMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A6e-23150211263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190199RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880330.0AB288033.1 Oryza sativa Japonica Group OsHAP2G mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK1016840.0AK101684.1 Oryza sativa Japonica Group cDNA clone:J033058N01, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015646559.10.0PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646560.10.0PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646561.10.0PREDICTED: nuclear transcription factor Y subunit A-4
RefseqXP_015646562.10.0PREDICTED: nuclear transcription factor Y subunit A-4
SwissprotQ9LNP66e-42NFYA8_ARATH; Nuclear transcription factor Y subunit A-8
TrEMBLI1QC270.0I1QC27_ORYGL; Uncharacterized protein
STRINGORGLA07G0166900.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.12e-33nuclear factor Y, subunit A5